PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A12G2645
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 314aa    MW: 35203.4 Da    PI: 7.5441
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A12G2645genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.46e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd + v +++++G+g+W++I+   g+ R+ k+c++rw +yl
      Gh_A12G2645 14 KGPWTPEEDIIMVSYIQEHGPGNWRSIPTNTGLLRCSKSCRLRWTNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding50.54.9e-1667112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T++E++ ++++ ++lG++ W++Ia++++  Rt++++k++w+++l
      Gh_A12G2645  67 RGNFTEQEEKMIIHLQALLGNR-WAAIASYLP-QRTDNDIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.2E-24564IPR009057Homeodomain-like
PROSITE profilePS5129417.393961IPR017930Myb domain
SuperFamilySSF466892.25E-3011108IPR009057Homeodomain-like
SMARTSM007178.4E-131363IPR001005SANT/Myb domain
PfamPF002493.4E-151461IPR001005SANT/Myb domain
CDDcd001672.64E-101661No hitNo description
PROSITE profilePS5129424.77562116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.4E-2565117IPR009057Homeodomain-like
SMARTSM007176.5E-1666114IPR001005SANT/Myb domain
PfamPF002493.1E-1567112IPR001005SANT/Myb domain
CDDcd001673.05E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0080167Biological Processresponse to karrikin
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MGRPPCCDKI GVKKGPWTPE EDIIMVSYIQ EHGPGNWRSI PTNTGLLRCS KSCRLRWTNY  60
LRPGIKRGNF TEQEEKMIIH LQALLGNRWA AIASYLPQRT DNDIKNYWNT HLKKKLKKVE  120
TGVDGQNQEG FSSAQSVSKG QWERRLQTDI RMAKQALSDA LSLDKPNSLT NSIEFKLSHP  180
YLRPSQSQSS TAYASSAENI SRLLQNWMKN PPKPAPAPRQ TKSVETMTQN SSSSDEGALS  240
EATPEGFDSF LTFNSSNSDN ISHESVSVAE NSVFQDESKP NLRLIEKWLL DDASGQAHDD  300
DLINMSLQDS AALF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-261411627128MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.121710.0boll| ovule
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00395DAPTransfer from AT3G47600Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012438755.10.0PREDICTED: myb-related protein 306
SwissprotP813921e-126MYB06_ANTMA; Myb-related protein 306
TrEMBLA0A0D2T3470.0A0A0D2T347_G
STRINGVIT_17s0000g06190.t011e-137(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47600.11e-116myb domain protein 94